| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MYLSCFDEECELWLPNLPLEGVSNKVCLHCVITGWVGTWNCMKMAASESEATQAFPNPPSILYKLYTDEAVESGSAPKPPPPVQGHYQMFGAPFNTGDAMIRSLEEQNVQRLYPQQYDKKVELKKLNRSILICFLELLDILIDNPSSPERNDKIKDLSILFINMHHLINEYRPHQARETLRVVLERQKRQRDEMIQQITRAMEKAQTILKTCDGSLKQLITTLPAAEDEQEEMETSQANEKTDQNPVTLDSFVDSQDRDLIKYVDTFK |
| Length | 268 |
| Position | Middle |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha> Haplosclerida> Niphatidae> Amphimedon. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.522 |
| Instability index | 57.26 |
| Isoelectric point | 4.97 |
| Molecular weight | 30825.81 |
| Publications | PubMed=20686567 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP13642
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.63| 21| 23| 46| 66| 1
---------------------------------------------------------------------------
46- 66 (37.08/20.24) ASESEATQAFPNPPSILYKLY
70- 90 (40.55/22.67) AVESGSAPKPPPPVQGHYQMF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.28| 23| 24| 201| 223| 2
---------------------------------------------------------------------------
176- 198 (31.79/18.06) ARETLRVVLERQKRQRD..EMIQQI
201- 223 (34.78/20.33) AMEKAQTILKTCDGSLK..QLITTL
225- 249 (29.71/16.48) AAEDEQEEMETSQANEKtdQNPVTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.98| 20| 28| 114| 141| 3
---------------------------------------------------------------------------
114- 137 (23.79/38.66) PQQYDKKVELKKLnrSILicFLEL
145- 164 (35.20/20.68) PSSPERNDKIKDL..SIL..FINM
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DRDLIKYV 2) SILYKLYTD | 257 60 | 264 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab