Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MYLSCFDEECELWLPNLPLEGVSNKVCLHCVITGWVGTWNCMKMAASESEATQAFPNPPSILYKLYTDEAVESGSAPKPPPPVQGHYQMFGAPFNTGDAMIRSLEEQNVQRLYPQQYDKKVELKKLNRSILICFLELLDILIDNPSSPERNDKIKDLSILFINMHHLINEYRPHQARETLRVVLERQKRQRDEMIQQITRAMEKAQTILKTCDGSLKQLITTLPAAEDEQEEMETSQANEKTDQNPVTLDSFVDSQDRDLIKYVDTFK |
Length | 268 |
Position | Middle |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha> Haplosclerida> Niphatidae> Amphimedon. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.522 |
Instability index | 57.26 |
Isoelectric point | 4.97 |
Molecular weight | 30825.81 |
Publications | PubMed=20686567 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13642 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.63| 21| 23| 46| 66| 1 --------------------------------------------------------------------------- 46- 66 (37.08/20.24) ASESEATQAFPNPPSILYKLY 70- 90 (40.55/22.67) AVESGSAPKPPPPVQGHYQMF --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 96.28| 23| 24| 201| 223| 2 --------------------------------------------------------------------------- 176- 198 (31.79/18.06) ARETLRVVLERQKRQRD..EMIQQI 201- 223 (34.78/20.33) AMEKAQTILKTCDGSLK..QLITTL 225- 249 (29.71/16.48) AAEDEQEEMETSQANEKtdQNPVTL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.98| 20| 28| 114| 141| 3 --------------------------------------------------------------------------- 114- 137 (23.79/38.66) PQQYDKKVELKKLnrSILicFLEL 145- 164 (35.20/20.68) PSSPERNDKIKDL..SIL..FINM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DRDLIKYV 2) SILYKLYTD | 257 60 | 264 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab