<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13640
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEVHVTDVQRFELELEFVQSLANPQYLTFLGQRGYFKEKTFVNYLKYLQYWKTKEYSHFLKYPQCLHFLDLLQSEHFRRELSNAQCSKFIEEQQLLHWHLYTKKRMQHHIMAEKQSSNQTVKQQPLKNQ |
| Length | 129 |
| Position | Middle |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.786 |
| Instability index | 49.93 |
| Isoelectric point | 9.04 |
| Molecular weight | 15887.00 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 115.29| 20| 20| 58| 77| 1
---------------------------------------------------------------------------
21- 36 (23.88/11.05) ..LANPQYLTFLG.....QRGYF
37- 56 (30.18/15.51) KEKTFVNYLKYLQ...YWKTKEY
58- 77 (36.97/20.31) HFLKYPQCLHFLD...LLQSEHF
79- 98 (24.27/11.33) RELSNAQCSKFIEeqqLL...HW
---------------------------------------------------------------------------
|