<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13638
Description |
Uncharacterized protein |
Sequence | MPGTAQGIKEELLRAIDESGNVLDMKLLVSVLNDLESVRITAEDLTVTRLGLYINNARRQTKDKTLARRMKDLLKEWKILVQNSQSNGVAPPSQLTTPSISPAPLSTTPALALSEEPSSESGLVTPKQNPQLSHRKLLLSKLSAFKKPQTTPTATPPTIEPINTSHSLPLAPPPPLHVSNGKPGSTNNSLTIRYPLDRLPKQQETRGPLIVSISLSLIKLSGRNEAPPTEGVPLLHPGLNERSSPLSFQSLSPVSYQETRPSPLPPPSLSLPLPPPPSLSLPPSPSSLTPPLIVSIPLSLLTSPTLVPAARNRSRXXXXRLGNRSRRQCNRYMKKKPVPLGTSLTVYLVKLYVA |
Length | 354 |
Position | Unknown |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.336 |
Instability index | 64.60 |
Isoelectric point | 10.30 |
Molecular weight | 37904.50 |
Publications | PubMed=20686567
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13638
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 167.99| 39| 101| 161| 199| 2
---------------------------------------------------------------------------
96- 142 (43.89/ 9.67) TTPSISPAPLSTTPALALSE.EPSSESGLVT...PkqnpqlshrkllLSKL
161- 199 (73.25/20.12) PINTSHSLPLAPPPPLHVSNGKPGSTNNSLTIRYP............LDRL
270- 301 (50.84/12.14) ......SLPLPPPPSLSLPPS.PSSLTPPLIVSIP............LSLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.78| 14| 73| 256| 269| 3
---------------------------------------------------------------------------
223- 239 (21.28/ 6.01) RNEAPPTegvPLLHPGL
256- 269 (29.50/11.05) YQETRPS...PLPPPSL
---------------------------------------------------------------------------
|