<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13635
| Description |
Uncharacterized protein |
| Sequence | PWPRITIYINPHSQTRQLITSHTPPLSIDLSLVPNKLSFQDVLVQCIKYRSLSILERLKKLFNDTPWENKAVLHSSPPCLSLSLSSSLVDHQLILSVDIRIGLVVASLEGVVRHNNELINKTLQSIEEELLHDPNQQSLIKHLETLLCQLHLFQLTCLSSSVGLSHSFSLPLLSPLPEVPSPVFIKLDHVTYLLVSVSIEGGVAVGGVTESYYMLRVFPSPYLPLVSDEQIPRSFFKIESLIRISTSSAFDHMTGIISMLQGTSKLKRK |
| Length | 269 |
| Position | Tail |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.166 |
| Instability index | 53.10 |
| Isoelectric point | 7.53 |
| Molecular weight | 30089.70 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13635
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.53| 11| 49| 22| 32| 1
---------------------------------------------------------------------------
22- 32 (20.67/12.07) HTPPLSIDLSL
74- 84 (19.86/11.28) HSSPPCLSLSL
---------------------------------------------------------------------------
|