<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13633
Description |
Uncharacterized protein |
Sequence | MASNGDAGFKVSVESLHTTRVKEINYDGEEIYEGRPLSQKLRKKKQEEEEEEGVSGPITKKPSHCWPWEFTHSKLKQALTEVSVLSDVLQIVHNHHQYLSLDPVYVNKKYTLPPSYQYQIKKKALDVASKILRKGAEPLKRLSSQTDHKFYRALYDLRRRWILRRTANGVSGDLSYRSAGSLYAQSVQFEVHKGIEGTNDILSAVVPQELRGRSEVVIFLADRPIKEVVSLDSLLPSCFIELHKQQLTLTPWEQILKSAQNVLFNEELFAQIVQSFVMRNLYYIM |
Length | 285 |
Position | Head |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.446 |
Instability index | 62.17 |
Isoelectric point | 8.97 |
Molecular weight | 32807.15 |
Publications | PubMed=20686567
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13633
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.61| 22| 28| 123| 149| 2
---------------------------------------------------------------------------
115- 137 (33.05/30.40) SYQYQIK.kKAL.DVASK.ILRKGAE
143- 168 (24.56/ 9.74) SSQTDHKfyRALyDLRRRwILRRTAN
---------------------------------------------------------------------------
|