<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13627
| Description |
Uncharacterized protein |
| Sequence | MASNGDAGFKVSVESLHNTRVKEINYDGEEIYEGRPSLSQKLSELAQHVDFREERADDDNDREEGKKKQEEEEEEGVSGPTTKKPSHRWPWEFTHSKLKQALTEVSVLSDVLQIVHNHHQYLSLDPVYVNKKYTLPPSYQYQIKKKALDVASKILRKGAEPLKRLSSQTDHKFYRALYDLRRRWILRRTANGVSGDLSYRSAGSIYAQSVQFEVHKGIEGTNDILSVVVPQELRGRSEVVIFLADRPIKGNGMSHDYHMIVHVIYVYMLMWFLFXXXXAIKKNYSHKSYLVQVGVVVGGVKDDVH |
| Length | 305 |
| Position | Head |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.602 |
| Instability index | 53.85 |
| Isoelectric point | 8.43 |
| Molecular weight | 34601.74 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13627
No repeats found
|