<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13626
| Description |
Uncharacterized protein |
| Sequence | VHRSIGVLLVSFVPIRLIALDVASKILRKGAEPLKRLSSQTDHKFYRALYDLRRRWILRRTANGVSGDLSYRSGIRARFILCTCILITIILIMAVIALTFLFIYKNTQHFDAQNISVYNGYVTSIYYDQFYVNEVNLISDSPATASVYVVPQSQLSYIPVMLPEKQIDKRNSTFPQRFELHYDRSENNLICNTVCELNFRFELQENGVISGCLAQLFLYDNKTDLDKVFKPNEPHGSVGDPVAQTCLPKTGVVNKKFHLPPNKLYYIGWYVAKNVGYTIWLSANLTRINISGLNEDCSVSSQHTTCSITHTKYPYKKENISLLFNTTSTTMMDVNVTPVLVQWNLQRLIGVSASSCIGAVAVMVAVSVLFYYCMIRTVARSGYNAIA |
| Length | 387 |
| Position | Head |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.093 |
| Instability index | 52.99 |
| Isoelectric point | 9.22 |
| Molecular weight | 43797.24 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13626
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.81| 17| 22| 177| 197| 1
---------------------------------------------------------------------------
177- 197 (27.05/30.55) RFELHydrsENNLICNTVCEL
200- 216 (30.76/21.30) RFELQ....ENGVISGCLAQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.05| 11| 22| 46| 58| 2
---------------------------------------------------------------------------
46- 58 (17.33/16.59) YRAlyDLRRRWIL
71- 81 (20.72/11.75) YRS..GIRARFIL
---------------------------------------------------------------------------
|