<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13624
| Description |
Uncharacterized protein |
| Sequence | ALDVSSKILRKGAEPLKRLSSQTDHKFYRALYDLRRRWILRRTVNGVSGDLSYRSAGSLYAQSV |
| Length | 64 |
| Position | Head |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.522 |
| Instability index | 94.81 |
| Isoelectric point | 10.67 |
| Molecular weight | 7327.29 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13624
No repeats found
No repeats found
|