<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13611
| Description |
Uncharacterized protein |
| Sequence | QALTEVSVLSDVLQIVHNHHQYLSLDPVYVNKKYTLPPSYQYQIKKKALDV |
| Length | 51 |
| Position | Head |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.292 |
| Instability index | 34.94 |
| Isoelectric point | 8.24 |
| Molecular weight | 5925.74 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13611
No repeats found
No repeats found
|