<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13609
Description |
Uncharacterized protein |
Sequence | SPVLVTEQQRLYLLLLVQSRLCSVDGNLNDMFNTLHHFCLSLQLDCLHAEVERLSVAVCGVYMKVEDYVPGHLIRLVYWRHTGPAYLLNNTSCKYH |
Length | 96 |
Position | Tail |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.153 |
Instability index | 42.38 |
Isoelectric point | 6.55 |
Molecular weight | 11075.76 |
Publications | PubMed=20686567
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13609
No repeats found
No repeats found
|