<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13608
Description |
Uncharacterized protein |
Sequence | MMEKRYEGRLSLSQKLSELAQHVDFREERADDDNDREGKKKQEEEEEGVSGPKTKKPSHHWPWEITHSKLKYINTCI |
Length | 77 |
Position | Head |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.499 |
Instability index | 36.26 |
Isoelectric point | 6.08 |
Molecular weight | 9169.10 |
Publications | PubMed=20686567
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP13608
No repeats found
No repeats found
|