<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13595
Description |
Uncharacterized protein |
Sequence | MAANYWDSTQAKFWTFAKAELSDLRKDLEKTNQPLHNRYTLPDRRLMNIYIQQQLVKLARRMSLRQQALATAQIYIKRFYLRVEMRKTNPYLIMATAVYLACKMEECPQHIRLMLGEAARQWPELGVTETSKIGECEFALISTLSSRLICHHPYRSLSELGPIFGLSSEETQLAHSIVNDSYNTDLPLLYAPHIIAITAVFLAVVLRPSGQPPGLQAHSTQGSPVQLSSGMISPLSSSMPSFSPSVSGNAAQQAFLGGFSGLKQAGPKLSKLVDWLAESKVDMNSIVDATQELVSLYEVWESYSERTCKEAITKFVKDAGMAGGGLLNK |
Length | 329 |
Position | Kinase |
Organism | Zymoseptoria tritici ST99CH_3D7 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.138 |
Instability index | 54.30 |
Isoelectric point | 8.70 |
Molecular weight | 36593.76 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13595
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.36| 19| 24| 35| 57| 1
---------------------------------------------------------------------------
35- 53 (35.34/27.96) LHNRYTLPDRRL..MNIYIQQ
58- 78 (27.02/11.37) LARRMSLRQQALatAQIYIKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.74| 22| 24| 222| 243| 2
---------------------------------------------------------------------------
222- 243 (39.32/26.03) GSPVQLS.SGMISPLSSSMPSFS
248- 270 (33.42/21.05) GNAAQQAfLGGFSGLKQAGPKLS
---------------------------------------------------------------------------
|