<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13593
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MALPPEHFKALDQLRLRLSQLSTSIGLLRNELEREQPLPTWPELQTAASSLGSNLQNLAATLSSQRQLFSSEHAYPLPDFPGHTQEGLLQQLLRKKLDPKAEAWISESLEGDKKTQNGTAEEEATLSSEDTMALWSWAGNAIGEMRTEMEDSGAFRDDYTLAERQAGISSVVTGIRRKLGRDMDSEDEDDDEDDDGNMDTKDEELKDGHEADASPSQSASLEGFNPTAPPIPLDTLLRFATGSNPLQAGSGL |
| Length | 252 |
| Position | Head |
| Organism | Zymoseptoria tritici ST99CH_3D7 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.723 |
| Instability index | 46.95 |
| Isoelectric point | 4.36 |
| Molecular weight | 27595.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13593
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.36| 35| 36| 4| 39| 1
---------------------------------------------------------------------------
5- 39 (58.88/34.41) PEHFKALDQLRLRLSQLSTSIGLLRNELEREQ..PLP
42- 78 (53.48/26.22) PELQTAASSLGSNLQNLAATLSSQRQLFSSEHayPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.16| 15| 35| 142| 158| 3
---------------------------------------------------------------------------
142- 158 (23.49/20.05) IG.EMRTEMEDSGafRDD
179- 194 (23.67/12.89) LGrDMDSEDEDDD..EDD
---------------------------------------------------------------------------
|