<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13582
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSRVESNDISSLYPPPPPYMKFFTNENLEKLAGYKQENESKETKKPSEEIDGTAEETISSELDFLTPPPMPSTHQYRAFGSVWQVKDELPDLETLGITRLYKKSDTDTNGDVPTSYQYKTQELRKLLKSLLLNYLELVGVLSVNPELYEPKMENIRTILTNIHHLLNEYRPHQSRESLIMLLEEQLEHKKTEIQQIHEVCRQVQKRLDSIQQSI |
| Length | 214 |
| Position | Middle |
| Organism | Kazachstania saulgeensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.765 |
| Instability index | 53.68 |
| Isoelectric point | 5.25 |
| Molecular weight | 24934.93 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13582
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.76| 13| 50| 6| 18| 1
---------------------------------------------------------------------------
6- 18 (27.25/14.15) SNDISSLYPPPPP
59- 71 (26.51/13.62) SSELDFLTPPPMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.08| 22| 32| 113| 142| 2
---------------------------------------------------------------------------
113- 134 (38.54/35.55) PTSYQYKTQELRKLLKSL..LLN.Y
145- 169 (30.55/12.39) PELYEPKMENIRTILTNIhhLLNeY
---------------------------------------------------------------------------
|