<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13579
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MSGSYKVLQNEDLSRIQEILIPPKSENETFTIPPGSSSSKSSSTQSTVATTEFIPHIFYTLYQIQKDPNRSNNQLETKTGLIRHRLRNCKTLIRESDSSLELLSKSTNEWEQFITNRENELQIKKNVLLDLRSKISEILTNCNYEPDSEETDPVTEGKEEQQGELQQENKVEESEQGVKEEGEQSVKEENVQDNNEEEKSVNLKKNETEKINSPEQINEHQETVVETDNKSDKNNNNDDNSNPETATAELPNDDNEIQSTSVADDDNAILDDIEMEM |
| Length | 277 |
| Position | Middle |
| Organism | Kazachstania saulgeensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.196 |
| Instability index | 62.78 |
| Isoelectric point | 4.35 |
| Molecular weight | 31583.72 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13579
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.59| 20| 20| 157| 176| 2
---------------------------------------------------------------------------
147- 169 (29.07/12.39) DSEETDpvtEG.KEEQQGELQQEN
170- 190 (28.53/12.04) KVEESE...QGvKEEGEQSVKEEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.77| 17| 20| 206| 223| 4
---------------------------------------------------------------------------
206- 223 (25.26/13.56) NETEKINSPEQiNEHQET
229- 245 (29.51/12.42) NKSDKNNNNDD.NSNPET
---------------------------------------------------------------------------
|