Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | METTPSYYYYVDPEVTYTPQQPNPLDDLMSVYGLSDLANQVARTNKDGSKAVKLRKSYKNQISDLSAKFSTIPNRENGKGGEIANIVFQNNQDMLAQVTRTPEMTDQDYHNAMINRDASLFNAPNMDWNLCQDVLSQFGRSYPSEFQDQQGFQIDDLAFDLDGTGKMTKKRKNRSSGSSIATPNSDVPDDLKRRRLE |
Length | 197 |
Position | Head |
Organism | Kazachstania saulgeensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.901 |
Instability index | 44.41 |
Isoelectric point | 5.11 |
Molecular weight | 22325.45 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13577 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.94| 16| 39| 92| 107| 1 --------------------------------------------------------------------------- 92- 107 (30.68/18.36) QDMLAQVTRT.P.EMTDQ 132- 149 (22.25/11.83) QDVLSQFGRSyPsEFQDQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDLKRRRLE 2) GFQIDDL 3) SYYYYVDPEVTYTP | 189 151 6 | 197 157 19 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab