<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13571
| Description |
Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex |
| Sequence | MTDRLTQLQICLDQMMEQFCATLNYIDKNHDFEPSHPLEAKMSDKHATVSNPEEFSNTIDELSTDIILKTRQVIKLIDSLPGVDVSTEEQMHRIDALQKSLVDTENKKIEAIKEKEKLLKNVDDLITLFVSGIADSRRNLNSTNDNVMSDNFKESNVTNIDIPSKDL |
| Length | 167 |
| Position | Middle |
| Organism | Kazachstania saulgeensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.548 |
| Instability index | 40.65 |
| Isoelectric point | 4.69 |
| Molecular weight | 19023.25 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13571
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.82| 12| 15| 77| 88| 2
---------------------------------------------------------------------------
77- 88 (20.97/13.48) IDSLPGVDVSTE
94- 105 (19.85/12.46) IDALQKSLVDTE
---------------------------------------------------------------------------
|