<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13570
Description |
Similar to Saccharomyces cerevisiae YBR253W SRB6 Subunit of the RNA polymerase II mediator complex |
Sequence | MSNQALFEKLSQTSELLSVKLAQLIRLSSLENIDDNDDDTNSPNEGSTLGNTLTSETDISVATSGVMLVNSQTMQLVKGVQDLLLLTRNIREKWILNQIPEKTETEVPAINYEELDGLLEKCMEEIIGEANL |
Length | 132 |
Position | Head |
Organism | Kazachstania saulgeensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.269 |
Instability index | 41.41 |
Isoelectric point | 4.13 |
Molecular weight | 14624.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13570
No repeats found
No repeats found
|