<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13563
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNTPLDELQWKSPEWIQAFGLRTENVLDYFSESPFFDKTSNNHVIKMQRQFSQMPGEAPPQTNGKQENENGSQENNGNNSQFNSSLLPQHDFSQAQNEFSHVEPSRRDVLTKYPMYAALERELSKLKGVEYVLACVREPDFWIIKKQNRLSSNQTDVLQDYYVIGANVYQAPTMFKVIQNRLMSTNYHLSQTIKNLHKLTQFQPSHGMQFKSTASLSSQTVMPNGSTVTSVPATAATTTTTGTFSTATTMNTAAQTANSAQYDNSRSRDMITKDMMDKLMITSIKSKPEYIQ |
| Length | 292 |
| Position | Head |
| Organism | Kazachstania saulgeensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.704 |
| Instability index | 41.11 |
| Isoelectric point | 7.02 |
| Molecular weight | 33100.65 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13563
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.84| 24| 30| 173| 200| 1
---------------------------------------------------------------------------
141- 170 (33.31/19.84) FWIIkkQNRLSSNQTDVLQDYyvigANVYQ
175- 198 (42.52/26.70) FKVI..QNRLMSTNYHLSQTI....KNLHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.82| 21| 158| 94| 115| 2
---------------------------------------------------------------------------
94- 115 (34.51/31.61) QAQNEfSHVEPSR.RDVLTKYPM
255- 276 (34.31/25.07) QTANS.AQYDNSRsRDMITKDMM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.53| 19| 26| 204| 222| 4
---------------------------------------------------------------------------
204- 222 (33.06/23.40) PSHGMQFKSTASLSSQTVM
232- 250 (31.47/21.91) PATAATTTTTGTFSTATTM
---------------------------------------------------------------------------
|