<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13559
| Description |
Uncharacterized protein |
| Sequence | MLQELSHMDRITQLQDEIQQFLTIMSSSIAYLTSRANFLQVSPEVPITKQRKAEKYDPPEVLEANKKELVADLVVKAKQIELLIQSLPEPEPEEAQARRLQGLEEEMVEANAEYIRAVNRAKSLHQRMSLLLRTMLDEVELPDDAPG |
| Length | 147 |
| Position | Middle |
| Organism | Postia placenta MAD-698-R-SB12 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Dacryobolaceae> Postia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.440 |
| Instability index | 71.94 |
| Isoelectric point | 4.79 |
| Molecular weight | 16809.08 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13559
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.53| 12| 28| 58| 69| 1
---------------------------------------------------------------------------
58- 69 (21.24/10.65) P.PEVLEANKKEL
88- 100 (18.29/ 8.41) PePEPEEAQARRL
---------------------------------------------------------------------------
|