<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13535
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MDSTTTTTSSALVAYLDPHTIQELEALRGKLGSLQETLSTQIAYLKEPKFHFTWPDLLNKFNMLTAKFSSLSEDFHQFTQTGSTATLPKLMLHPWTPPVTEQDTNIFSVLLRTKLIPDIEAVEKETLRTIQQEMPQQQQQQWNLQQQQQQLQQQERRVDDDQMIKEQIHQWQKLRERHDLLAEEAASLTQELSSRYGDVILLRVEEENNDNNQPVTSGMNSMMDDDDKEDQGPEWKQQGFTSEENWKRYQLECMMTFYSMGKDSLVGSDLKSK |
| Length | 273 |
| Position | Head |
| Organism | Absidia repens |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Cunninghamellaceae> Absidia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.845 |
| Instability index | 54.62 |
| Isoelectric point | 4.74 |
| Molecular weight | 31791.17 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13535
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.58| 16| 16| 124| 139| 1
---------------------------------------------------------------------------
124- 139 (27.53/10.86) KETLRTIQQEMPQQQQ
141- 156 (29.06/11.77) QWNLQQQQQQLQQQER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.24| 16| 16| 163| 178| 2
---------------------------------------------------------------------------
163- 178 (29.22/20.21) MIKEQIHQWQKLRERH
181- 196 (24.02/15.37) LAEEAASLTQELSSRY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.47| 15| 23| 38| 53| 3
---------------------------------------------------------------------------
38- 53 (22.85/21.83) LSTQIAYLKEpKFH.FT
64- 79 (22.62/14.95) LTAKFSSLSE.DFHqFT
---------------------------------------------------------------------------
|