<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13522
| Description |
Uncharacterized protein |
| Sequence | MARMFTNSIYYVHEKSNMVELNKDIPVLQPKVQADTPEIFEQNVKELVSDLGKKAKEIDTLIEGLPGIQRTEEEQVSAD |
| Length | 79 |
| Position | Middle |
| Organism | Absidia repens |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Cunninghamellaceae> Absidia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.532 |
| Instability index | 42.88 |
| Isoelectric point | 4.68 |
| Molecular weight | 8991.11 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13522
No repeats found
No repeats found
|