Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MASSLRDQVNELLTEYASVTQRYFQSMLQVAEDNQLDRHHSPELYIQEMIKVDSQLQMALDQIGEHQARQQQIIQVQDEIQQHQSTLLSMVEKLNIANQDLDQTLSAAKKELKAVDYAKNGKDIYYPVVNMTNIQFTDILSYASKLSKYTSAPPNFDLMNRDIKVDFEKPYPDEERMRRGLLYWQHSSQPIPEDKYESSDNESMEDVSNTKNEEPVAKPEEDRPTAFWHLDLNP |
Length | 234 |
Position | Middle |
Organism | Absidia repens |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Cunninghamellaceae> Absidia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.845 |
Instability index | 48.53 |
Isoelectric point | 4.68 |
Molecular weight | 27259.03 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13521 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.09| 13| 19| 23| 37| 1 --------------------------------------------------------------------------- 23- 37 (20.14/18.75) YFQSMLQVaeDNQLD 45- 57 (23.95/15.08) YIQEMIKV..DSQLQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.77| 17| 17| 159| 175| 3 --------------------------------------------------------------------------- 159- 175 (30.31/18.62) MNRDIKV..DFEKPYPDEE 177- 195 (25.46/14.64) MRRGLLYwqHSSQPIPEDK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEPVAKPEEDRPTAFWHLDLN 2) GLLYWQH 3) PIPEDKYESSD | 213 180 190 | 233 186 200 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab