<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13515
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MDLQRNAHVGLDPNTIQELETLRGKLWSLQETFAAQIAYLKEPKYPFTWPDLLNKFNMLTAKFASLSDDFYGYIETGSNATLPKLMLHPFIPTTTEQETNISSVLLRTKLIPDIERLELETQAAVARELSSHTTDHHHHHHHHHNNNNINNNNDTNNNNNGAEDDEQLIRSHYEQWTSHKQRHDRIAVDAANFVADLVNDYREDFLLRIEDQEAQEKEENEDEEDRDRAEDKAKPEEQEEGDEAWEKMGFPNKETWRRWKLECLVNLYSSGKDEVPGSDLKKMATRPAY |
| Length | 289 |
| Position | Head |
| Organism | Syncephalastrum racemosum (Filamentous fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Syncephalastraceae> Syncephalastrum.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.044 |
| Instability index | 51.74 |
| Isoelectric point | 4.96 |
| Molecular weight | 33717.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13515
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.69| 16| 18| 208| 223| 1
---------------------------------------------------------------------------
208- 223 (27.10/16.87) RIEDQEAQEKEENEDE
228- 243 (27.60/17.32) RAEDKAKPEEQEEGDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.76| 17| 18| 76| 92| 2
---------------------------------------------------------------------------
76- 92 (30.37/25.88) TGSNATLPKLMLHP.FIP
95- 112 (22.39/17.13) TEQETNISSVLLRTkLIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.24| 20| 204| 48| 69| 3
---------------------------------------------------------------------------
13- 32 (34.08/15.58) PNTIQELETLRGKLWSLQET
50- 69 (33.16/14.74) PDLLNKFNMLTAKFASLSDD
---------------------------------------------------------------------------
|