<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13512
| Description |
Uncharacterized protein |
| Sequence | MTQKAKLLGSQDLLSYYNLIPIYDKYVRPYPPPDRAASLEPTLHNYIADLPGKNDVEPDGFLLNILRDPQIPERGPPITRLEDDVLRDAYALTPGPIPGFDASILGNDEGATETMLPVAVDGSTEKKHKKKKKKRKHSHEHEEDGHHSEHKKKKKRKKADE |
| Length | 161 |
| Position | Head |
| Organism | Syncephalastrum racemosum (Filamentous fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Syncephalastraceae> Syncephalastrum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.032 |
| Instability index | 45.92 |
| Isoelectric point | 7.90 |
| Molecular weight | 18221.43 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13512
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.57| 15| 19| 121| 136| 1
---------------------------------------------------------------------------
121- 136 (22.71/13.17) DGStEKKHKKKKKKRK
144- 158 (28.86/13.21) DGH.HSEHKKKKKRKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.76| 15| 17| 62| 78| 2
---------------------------------------------------------------------------
43- 60 (20.34/ 7.77) LHNYIAD..LPGKNdvePDG
62- 78 (22.41/14.97) LLNILRDpqIPERG...PPI
---------------------------------------------------------------------------
|