<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13466
Description |
mediator of RNA polymerase II transcription subunit 22 isoform X1 |
Sequence | MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFDEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK |
Length | 143 |
Position | Head |
Organism | Drosophila ficusphila (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.580 |
Instability index | 45.46 |
Isoelectric point | 5.47 |
Molecular weight | 16579.73 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13466
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.30| 19| 55| 49| 67| 1
---------------------------------------------------------------------------
49- 67 (33.48/25.05) SQISKTTQCEQDALEMQVR
105- 123 (33.82/25.37) SQLFRNTQSECDKKLMKLR
---------------------------------------------------------------------------
|