Description | mediator of RNA polymerase II transcription subunit 28 |
Sequence | MTSNEPGGGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGAGMLQGPGGGMSPMGGVPPRPGMMPGIPPGAMQPGGPMQPSPQHMLQAQQMQQLRMMGKLPPK |
Length | 189 |
Position | Head |
Organism | Drosophila ficusphila (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.611 |
Instability index | 71.41 |
Isoelectric point | 6.32 |
Molecular weight | 21015.11 |
Publications |
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP13454 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 93.57| 21| 25| 116| 139| 1 --------------------------------------------------------------------------- 116- 132 (17.17/ 8.15) .........GVHSRPTPpigAGMLQG 133- 152 (36.80/12.02) PGGGMSPmgGVPPRP......GMMPG 154- 173 (39.60/13.38) PPGAMQP..GGPMQPSP...QHMLQ. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.12| 20| 22| 1| 20| 2 --------------------------------------------------------------------------- 1- 20 (36.66/20.19) MTSNEPGGGNLMDEFEEAFQ 26- 45 (33.46/17.91) LTKQEPNSGTNKEEIELEVQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.45| 17| 22| 73| 90| 3 --------------------------------------------------------------------------- 73- 90 (25.45/24.54) KPYMLIKDENQDLSiEIQ 98- 114 (31.99/25.04) KHYNRLEEWKACLS.DIQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LMDEFEE 2) LRMMGKLPPK | 11 180 | 17 189 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab