<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13454
| Description |
mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MTSNEPGGGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGAGMLQGPGGGMSPMGGVPPRPGMMPGIPPGAMQPGGPMQPSPQHMLQAQQMQQLRMMGKLPPK |
| Length | 189 |
| Position | Head |
| Organism | Drosophila ficusphila (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.611 |
| Instability index | 71.41 |
| Isoelectric point | 6.32 |
| Molecular weight | 21015.11 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13454
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.57| 21| 25| 116| 139| 1
---------------------------------------------------------------------------
116- 132 (17.17/ 8.15) .........GVHSRPTPpigAGMLQG
133- 152 (36.80/12.02) PGGGMSPmgGVPPRP......GMMPG
154- 173 (39.60/13.38) PPGAMQP..GGPMQPSP...QHMLQ.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.12| 20| 22| 1| 20| 2
---------------------------------------------------------------------------
1- 20 (36.66/20.19) MTSNEPGGGNLMDEFEEAFQ
26- 45 (33.46/17.91) LTKQEPNSGTNKEEIELEVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.45| 17| 22| 73| 90| 3
---------------------------------------------------------------------------
73- 90 (25.45/24.54) KPYMLIKDENQDLSiEIQ
98- 114 (31.99/25.04) KHYNRLEEWKACLS.DIQ
---------------------------------------------------------------------------
|