<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13451
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAKMYGKGKTAIESEEQQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQANGVEAATGGEAAAATPNVNGAAATADGQAAATALQPVQTQAGNPQQQQQINGLASAANIKLELN |
Length | 203 |
Position | Middle |
Organism | Drosophila ficusphila (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.591 |
Instability index | 60.02 |
Isoelectric point | 7.61 |
Molecular weight | 23223.95 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13451
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.68| 13| 18| 140| 157| 1
---------------------------------------------------------------------------
140- 152 (22.86/ 8.01) NGVEAATGGEAAA
158- 170 (22.82/20.36) NGAAATADGQAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.81| 15| 18| 67| 81| 2
---------------------------------------------------------------------------
37- 60 (16.35/ 7.04) YLNF...LAqrgffkdqsFINYLKYLQ
67- 81 (27.84/15.73) YAKY...LM.........YPMCLYFLD
85- 102 (21.62/11.03) YEHFrreIV.........NSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.21| 15| 49| 124| 138| 3
---------------------------------------------------------------------------
124- 138 (28.24/12.10) TAAQQQQQQL...QQQQQ
171- 188 (22.97/ 8.67) TALQPVQTQAgnpQQQQQ
---------------------------------------------------------------------------
|