<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13442
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAKMYGKAAIESEEQQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQANGVEAATGGEAAAATPNVNGAAATADGQAAATALQPVQTQAGNPQQQQQINGLASAANIKLELN |
Length | 201 |
Position | Middle |
Organism | Drosophila ficusphila (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.563 |
Instability index | 61.36 |
Isoelectric point | 6.73 |
Molecular weight | 23008.70 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13442
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.68| 13| 18| 138| 155| 1
---------------------------------------------------------------------------
138- 150 (22.86/ 7.22) NGVEAATGGEAAA
156- 168 (22.82/18.41) NGAAATADGQAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.81| 15| 18| 65| 79| 2
---------------------------------------------------------------------------
35- 58 (16.35/ 9.02) YLNF...LAqrgffkdqsFINYLKYLQ
65- 79 (27.84/20.01) YAKY...LM.........YPMCLYFLD
83- 100 (21.62/14.06) YEHFrreIV.........NSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.21| 15| 49| 122| 136| 3
---------------------------------------------------------------------------
122- 136 (28.24/11.88) TAAQQQQQQL...QQQQQ
169- 186 (22.97/ 8.45) TALQPVQTQAgnpQQQQQ
---------------------------------------------------------------------------
|