<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13434
| Description |
mediator of RNA polymerase II transcription subunit 29-like |
| Sequence | MNFRPTSNPGGNPQNIMPVRHPQPQQIVSTMNRMPTPAAVPMGTNVQNVRLRGAGTFPQRLPNQSSNTQQASAGNAQNKDPVHNAKAILPHLKESLVNLMAVASQNFAVSVSVDDMQKVVDASNVPRFDKCLEHFYNLCDQLELQLNLGHHQLSQALASIQHTPLMRNVNLKDDANGPQIYGNYINTVESQLQCAEEIQNLLLNCCKKLQEHQTTHPV |
| Length | 218 |
| Position | Tail |
| Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.513 |
| Instability index | 42.92 |
| Isoelectric point | 7.73 |
| Molecular weight | 24126.09 |
| Publications | PubMed=12481130
PubMed=15114417
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP13434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.37| 18| 29| 1| 20| 1
---------------------------------------------------------------------------
1- 20 (33.07/23.35) MNFRPTsnPGGNP..QNIMPVR
31- 50 (30.30/15.35) MNRMPT..PAAVPmgTNVQNVR
---------------------------------------------------------------------------
|