| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MEADEQRTSFVPFTKAERIQQLGDIDKKIVSLARSTGQAMQCLGKRIPHDGEVVMTDTDPIQQYKDSMDEFMGTLRTVNVGMKRQIWGLEEAGIISLGKKELNLREEGGEVQASNIRNGLLEPDGNGKIGGLDVGWLNSRSNKVEKDMEADLWREAEDALQQLLAHQQQYPDERMNDTAS |
| Length | 180 |
| Position | Head |
| Organism | Rosellinia necatrix (White root-rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Xylariaceae> Rosellinia. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.729 |
| Instability index | 34.58 |
| Isoelectric point | 4.76 |
| Molecular weight | 20191.43 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP13433 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LDVGWLNSR 2) VEKDMEADLWREAEDA | 132 144 | 140 159 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab