Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLTASVSQEDFDTACAILQGLSWMTARRTVYRILYFAGQPQPRSLPVTPQAELLPRQQDRQLWVELSRQLQRSSYVLQAAYEVSPETDFGRGGNNNNNIAAAAPTDLNRLPATLRWTDLPDPLRDSPITSRKKIEIPFRFNLRGVLLANQHTYTNELIQESYSFNQGDLEIMLSRYYHLPAEQIPGQPQSQSQPQPQPAPQLPPWADLRPVDPAQKWALTVKLHVAEDGQPERLAKATEELLRNKAELDRLFDFRPVDRRVFDTRVAPPPVVPGRAPP |
Length | 282 |
Position | Head |
Organism | Rosellinia necatrix (White root-rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Xylariaceae> Rosellinia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.582 |
Instability index | 77.90 |
Isoelectric point | 6.45 |
Molecular weight | 32102.94 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13432 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 151.26| 44| 153| 23| 67| 1 --------------------------------------------------------------------------- 23- 67 (81.46/38.39) QG.LSWMTARRTVYRILYFAGQPQPRSLPvTPQ.AELLPRQQD.R.....QLW 170- 221 (69.80/29.43) QGdLEIMLSRYYHLPAEQIPGQPQSQSQP.QPQpAPQLPPWADlRpvdpaQKW --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FRPVDRRVFD 2) YRILYF | 258 35 | 267 40 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab