<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13415
Description |
Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
Sequence | XEKCRIDTEILPSLFMRCTTDPNRKDRFPAITHLKFLARDMSEQVLLCASSQTSSLVECWSLRKEGLPVNNIFQQISPVVGDKQPMILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLARPHALWMSLP |
Length | 142 |
Position | Tail |
Organism | Rattus norvegicus (Rat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Rattus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.110 |
Instability index | 57.68 |
Isoelectric point | 8.80 |
Molecular weight | 15908.38 |
Publications | PubMed=15057822
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 ISO:RGD
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 ISO:RGD
transcription coactivator activity GO:0003713 ISO:RGD
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 ISO:RGD
positive regulation of transcription, DNA-templated GO:0045893 ISO:RGD
|
Interaction
Repeat regions
Repeats |
>MDP13415
No repeats found
No repeats found
|