Description | Mediator of RNA polymerase II transcription subunit 17 (Fragment) |
Sequence | SEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPG |
Length | 233 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.614 |
Instability index | 43.17 |
Isoelectric point | 5.37 |
Molecular weight | 25967.05 |
Publications | PubMed=16554811 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13405 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.77| 16| 17| 194| 209| 1 --------------------------------------------------------------------------- 194- 209 (26.67/16.64) P..SDLEGSAYIKVSIQK 212- 229 (24.10/14.46) PdiGDLGTVNLFKRPLPK --------------------------------------------------------------------------- |
Disease |
MoRF Sequence | Start | Stop |
1) LFKRPLPKS 2) SEEEEAAGTEGDAQEW | 222 1 | 230 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab