<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13384
Description |
Mediator of RNA polymerase II transcription subunit 17-like (Fragment) |
Sequence | MAAMSANAVNVSVSVEVGQEFAVQEIHYDGQEMYSQPPTMSEKLSKLAHKIDFNADEEDVTIEETNAKATFQPSLWPWDGVRSKLKAALTEVSVLADVLAIARHKKYLVLDPVSQEPVEHKTSAILLAKKKAINAAGDILLKGASNLRGATQQEQMGRRVSTDFHTELLLMRQSWRLRKAGSSILGDLSYRSAGSRFWQSGTFEVSKSAHALAISQGEVAAGQNQGPDPQRPPSSVKITLPSELEGISYIQVTIQK |
Length | 256 |
Position | Head |
Organism | Tropilaelaps mercedesae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.312 |
Instability index | 54.25 |
Isoelectric point | 6.61 |
Molecular weight | 27971.39 |
Publications | PubMed=28327890
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13384
No repeats found
|