<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13380
Description |
Mediator of RNA polymerase II transcription subunit 28-like |
Sequence | MSNTLVDELEAAFQACLAAAKNPDHFGPRDNHDERKAGVEQTVQKFLDTARQMECFFLQKRLVVSPQKAVQFIMEDNMELKNELARKEQLIEKYHTKLSDWQRLVNDASICGLGSGGGGGPSGQRGGAQGQPPQGPPMGVQGGAQMMGGGGQIMGVPQLGGMPPQQMVGSGGMISSANQQLGGGPLAYLERTTSNIGTPPSAGGHPMGGMPQGPPDGRR |
Length | 219 |
Position | Head |
Organism | Tropilaelaps mercedesae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.553 |
Instability index | 51.87 |
Isoelectric point | 6.42 |
Molecular weight | 23022.83 |
Publications | PubMed=28327890
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP13380
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.16| 21| 24| 145| 165| 1
---------------------------------------------------------------------------
144- 162 (34.11/10.27) ..A......QMMGGGGQIMGV.PQLGGM
163- 184 (33.43/ 9.94) PPQ......QMVGSGGMISSAnQQLGGG
185- 210 (28.62/ 7.58) PLAylerttSNIGTPPSAGGH.P.MGGM
---------------------------------------------------------------------------
|