Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAATGTKGKLLRVIDDMEIIAKELVENLLAPKVQKLSSQEHLQLAEMLVAKNFELKELLQQARKQEKVEEVIEALQEEVDRQDKDIHTLQSNLKEAENLLATAIYQAKQKLSSIQKASEKQVSSEELIKYAHRISASSAVAAPHNWQQGDTRRPYPTDIEMRQGFLGRMSDLPLPPTDAGRSMHEGGGSMGGTSVGAGPPGSFWQMNAPAGTVSSGPQDIKPHLPPLGLQAGAMDVKNEDVEVMSTDSSSSSSSDSQ |
Length | 257 |
Position | Middle |
Organism | Tropilaelaps mercedesae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae> Tropilaelaps. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.546 |
Instability index | 62.40 |
Isoelectric point | 5.24 |
Molecular weight | 27898.12 |
Publications | PubMed=28327890 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13377 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 107.08| 40| 70| 22| 64| 1 --------------------------------------------------------------------------- 22- 62 (59.37/37.37) KELVENlLAPKVQKLSS.....QEHLQLAEMLVAKN.FELKELL...QQA 69- 117 (47.70/21.32) EEVIEA.LQEEVDRQDKdihtlQSNLKEAENLLATAiYQAKQKLssiQKA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.53| 15| 19| 154| 169| 3 --------------------------------------------------------------------------- 154- 169 (26.85/17.33) PY.PTDI..EMRQGfLGRM 173- 190 (21.68/ 9.42) PLpPTDAgrSMHEG.GGSM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ELIKYAHRI 2) KNEDVEVM | 126 237 | 134 244 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab