<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13377
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAATGTKGKLLRVIDDMEIIAKELVENLLAPKVQKLSSQEHLQLAEMLVAKNFELKELLQQARKQEKVEEVIEALQEEVDRQDKDIHTLQSNLKEAENLLATAIYQAKQKLSSIQKASEKQVSSEELIKYAHRISASSAVAAPHNWQQGDTRRPYPTDIEMRQGFLGRMSDLPLPPTDAGRSMHEGGGSMGGTSVGAGPPGSFWQMNAPAGTVSSGPQDIKPHLPPLGLQAGAMDVKNEDVEVMSTDSSSSSSSDSQ |
| Length | 257 |
| Position | Middle |
| Organism | Tropilaelaps mercedesae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.546 |
| Instability index | 62.40 |
| Isoelectric point | 5.24 |
| Molecular weight | 27898.12 |
| Publications | PubMed=28327890
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.08| 40| 70| 22| 64| 1
---------------------------------------------------------------------------
22- 62 (59.37/37.37) KELVENlLAPKVQKLSS.....QEHLQLAEMLVAKN.FELKELL...QQA
69- 117 (47.70/21.32) EEVIEA.LQEEVDRQDKdihtlQSNLKEAENLLATAiYQAKQKLssiQKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.53| 15| 19| 154| 169| 3
---------------------------------------------------------------------------
154- 169 (26.85/17.33) PY.PTDI..EMRQGfLGRM
173- 190 (21.68/ 9.42) PLpPTDAgrSMHEG.GGSM
---------------------------------------------------------------------------
|