<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13375
| Description |
Transcription elongation factor S-II-like |
| Sequence | MGCEEEVLKIGKGLDKMVSAGPSEQGQALDMLKQLQSLPITLEILQKTRIGMTVNSLRKSSNDDDVISLAKTLIKNWKKLLGSTPAKGDESSGGTGGSTKDTSTKDKSKGQSQGGQPQNQTKAPPSSQAPPRQTSFPAAANTTDAVRLKCRELLAVALKGNGLPEGCDDVDPDDLARHIESVCFDEFNNTDMKYKNRIRSRVANLKDPKNPNLRLAVLIGSISPERLAKMTAEEMASDELKQLRQKLTKEAIDDHQMAVTGGTKTDLLKCGKCRKSNCTYNQVQTRSADEPMTTFVFCNECGHRWKFC |
| Length | 308 |
| Position | Unknown |
| Organism | Tropilaelaps mercedesae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.677 |
| Instability index | 46.76 |
| Isoelectric point | 8.82 |
| Molecular weight | 33647.95 |
| Publications | PubMed=28327890
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13375
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.05| 13| 15| 84| 97| 1
---------------------------------------------------------------------------
84- 97 (19.81/14.58) TPAKgDESSGGTGG
102- 114 (23.23/12.03) TSTK.DKSKGQSQG
---------------------------------------------------------------------------
|