Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | MLTGATNMMLHYNLEHTFNKFIGRKVKDKLSAFLPSLPGNIDIPAGADGTSESSLRKVIHQPPVGGKELVPLSGAQLAGFRLHPGPLPEQYRTANLQALKKKKHKKHRGSEIGPAGSGGPAGVAGGGAPGSVGTGLSGSTGGGGTLGSGAPGSNAVGSASQ |
Length | 161 |
Position | Head |
Organism | Tropilaelaps mercedesae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae> Tropilaelaps. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.322 |
Instability index | 37.23 |
Isoelectric point | 10.12 |
Molecular weight | 16067.04 |
Publications | PubMed=28327890 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13363 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.69| 36| 74| 38| 75| 1 --------------------------------------------------------------------------- 38- 75 (60.03/22.11) PGNIDIPAG.ADGTSESSLRKVIHQPPVGGKELvpLSGA 114- 150 (61.66/19.17) PAGSGGPAGvAGGGAPGSVGTGLSGSTGGGGTL..GSGA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GGAPGSVGTGLS 2) RTANLQALKKKKHKKHRGSEI | 126 92 | 137 112 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab