<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13362
| Description |
Uncharacterized protein |
| Sequence | MKQVESNATNFLKTLQGVESGLSKHIIYLTQVSTVQPHEGSSYAAQKVFHMALHRLEHARSRMNELERLRQTHLQQDAQYNPPMPSQMGAGQSGQQQGPMGGGGPMGSQTMGPQSQLGGGQGSMGGAQGPQGIGGMQSPMGGGGMGQMGQGQSGQMGGPLQGGQIGMGPGQGQMSGPIGQQGQIGQGSIMGQQGQLGGIGGGQMGGIGSIGQQNPMVQGGPIGGDQYGGPGMIGGTPGQMGMRPTGPGLMGQQAQMGGMGGMGRPPLGMGPQMGMGGLAGQMGPQGP |
| Length | 287 |
| Position | Head |
| Organism | Tropilaelaps mercedesae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.547 |
| Instability index | 49.62 |
| Isoelectric point | 9.52 |
| Molecular weight | 28617.16 |
| Publications | PubMed=28327890
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13362
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.55| 19| 20| 182| 201| 3
---------------------------------------------------------------------------
176- 196 (30.61/ 6.54) GPIGqQGQIGQ.GSImGQQGQL
197- 216 (37.94/ 6.85) GGIG.GGQMGGiGSI.GQQNPM
---------------------------------------------------------------------------
|