<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13361

Description Mediator of RNA polymerase II transcription subunit 30-like
SequenceMASPYHQGGGGHVPAMGGGGPGGGAMGPGSGSIGGYPPVPQMHPGAMSLEGHNGISNEQQDQDGNPQQDNQQQQQQEFNIPVMCRIGQETVQEIVSRASELFQLLRTLSPPTGNMNQQAQTMQEERKAKLNEILKIIQQLFKRLRRVYEICDMNCAGGEFSTLEPDVATIQLIPLEDERRKDEEEKKPLDSALQFMEERQHYQEQVYMKNRQIKEIIDMLRSVVCEVNTMLGMRKKHLPFSNRMSSYGKPKPMF
Length254
PositionHead
OrganismTropilaelaps mercedesae
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae> Tropilaelaps.
Aromaticity0.05
Grand average of hydropathy-0.759
Instability index69.94
Isoelectric point5.91
Molecular weight28515.12
Publications
PubMed=28327890

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13361
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.40|      12|      73|     144|     158|       2
---------------------------------------------------------------------------
  145-  158 (20.41/25.22)	RRVyeICDMNCAGG
  221-  232 (20.99/10.32)	RSV..VCEVNTMLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.67|      29|      56|     107|     135|       3
---------------------------------------------------------------------------
  107-  135 (48.58/29.36)	TLSPPTGNMN....QQAQTMQEERKAKLNEILK
  162-  194 (41.09/23.84)	TLEPDVATIQliplEDERRKDEEEKKPLDSALQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.53|      11|      14|      18|      29|       4
---------------------------------------------------------------------------
   18-   28 (24.73/ 6.59)	GGGPGGGAMGP
   34-   44 (25.80/ 8.03)	GGYPPVPQMHP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13361 with Med30 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MASPYHQGGGGHVPAMGGGGPGGGAMGPGSGSIGGYPPVPQMHPGAMSLEGHNGISNEQQDQDGNPQQDNQQQQQQEFNIPV
1
82










Molecular Recognition Features






MoRF SequenceStartStop




NANANA