<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13358
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MNVKENDDQQKMRFQIELEFVQCLANPNYLNFLAQRGFFKDKSFCNYLSYLQYWSRPEYAKFIKYPMCLYFLELLQYEHFRREIANGQCAKFIEDQQLLHWQHYTRKRARLVQRDWRLCISR |
Length | 122 |
Position | Middle |
Organism | Tropilaelaps mercedesae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
Aromaticity | 0.18 |
Grand average of hydropathy | -0.663 |
Instability index | 40.86 |
Isoelectric point | 9.14 |
Molecular weight | 15254.42 |
Publications | PubMed=28327890
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13358
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 89.32| 20| 21| 63| 82| 1
---------------------------------------------------------------------------
44- 61 (17.42/ 6.40) ....FCNY.LS...YLQYwsrPEYAK
63- 82 (39.36/22.17) IKYPMCLYFLE...LLQY...EHFRR
84- 106 (32.54/17.27) IANGQCAKFIEdqqLLHW...QHYTR
---------------------------------------------------------------------------
|