<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13357
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MDKEDKQVDQVVDVLLTRSNDLKNNIQQLIWKFENEYETLQWPAVLDNFALISGQMNNLLKVLRNDKIPKLRNWIILPLLVSPDPDPELQRLTEGRVPLFNHQAVPDYLRTLCDPEIERADQMILMKASQSPSDGSTKQVASHNKICQQVSEVIRSSREEWDIDTSRGIQQTSSAPDTAMLISAISTGKLLRGGNQGPGLGGQTLGTHSPKPMGASIGGPIGGGPVPNRGMNAPPTAGGKIPTATIKTNIKSGGAMSSHPYMR |
| Length | 263 |
| Position | Head |
| Organism | Tropilaelaps mercedesae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Mesostigmata> Gamasina> Dermanyssoidea> Laelapidae>
Tropilaelaps.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.468 |
| Instability index | 46.36 |
| Isoelectric point | 7.77 |
| Molecular weight | 28693.40 |
| Publications | PubMed=28327890
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13357
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.78| 10| 19| 193| 202| 1
---------------------------------------------------------------------------
193- 202 (20.64/ 9.49) GGNQGPGLGG
214- 223 (18.19/ 7.56) GASIGGPIGG
230- 239 (19.96/ 8.96) GMNAPPTAGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.76| 24| 26| 67| 91| 2
---------------------------------------------------------------------------
67- 91 (40.04/28.52) KIPkLRNWIILPLLVSPDPDPELQR
96- 119 (44.72/27.53) RVP.LFNHQAVPDYLRTLCDPEIER
---------------------------------------------------------------------------
|