<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13350

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMPHALTDSPSKGWSVALSNALKRHIRPEHLPLRELAARYPATQRDVADAVISLHDVESYSFVNPLIPKYIEALVLARSTDISDVLLSLLQHSAFVKHSPSEHEESLASVFPSLEEQVFSLLRVLVINSKLPASQWRSKATTFTLTRWLHEARKVNEREVGKQLSAGLMAAGAGAHTGIFESLCLLVISIFGQPTFREIEKQRWWTSRKQAIAVEMQSYDANVLQWLQSQYTGHLQNLTKNRPFRVLDDKGMPIFTDEELLMTIPALPMSNTRAGLFIWLNACLCARPLTDDASMRNHALVRYSENVQEAAAGLIVASFDVLTNAILRGDSSRIIRSFVCNKLPLLLQGLFSFAEPNASEAAIQGTLSAVNMEPLSPLTAGATEARDVLKKTRADFLRACVMHTLVSDTVASAMSPEPSATTAKATRYSREGLMTQCAHNTARLEAIIMELDSMQGNAGAIAGCLIGIVNNLVTAKDTMTLKSVCNVLLRKIELVDVLLQYTQPADLLTPLYRTLDDWVHDEDQSEFQPPYEEFACILLLVLVIHHRFDLTAHEAGAFTMDGFVAKVLFGQWQSYTTAELSEQQIAQLSKWIEGLYATDEHGETTGIGDEVMSHCPPQAFYVLVPTLFEQSVLACKSGQMSVETARGGLEFLLEPFLLPSLVGGLLWIVKRSWEDHADGDILLQILDKLLRPSSSSQDMQVMHKAILAIVATPLVKSLKTLVLQRPDKRKEAESLIAIPTPHLHRRRALASSAPDEASSKGAIDQLRKAMKELIEWATGGGQGTPPIYDSTVIHAATSSSGYAATLQVIIDELAVQTSSHRGPIALDICTATACAPTPSSYISLLELSNQLVNTLRRTSTLRDRLRLCAANVQALQELPSAEAAALIQLSRAMAAQSAISPSALVSLSNPAAEQAVTDQVMKDLGLTTEGATLDDSLFDPAATFDNDTDFANVNFDVAADATLNLTESQTQDINNLMAADTSGMQIDPSANMFIADSIVFDANQPVLTGNDALMGNSGNVENAEEDIFAGLDFEQETMDFNFD
Length1042
PositionTail
OrganismRachicladosporium sp. CCFEE 5018
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium> unclassified Rachicladosporium.
Aromaticity0.06
Grand average of hydropathy-0.003
Instability index50.82
Isoelectric point5.02
Molecular weight113821.42
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13350
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.29|      24|      27|     711|     737|       1
---------------------------------------------------------------------------
  711-  737 (34.32/30.43)	TPLVKSLKTLVLQRPDkrkEAESLIAI
  739-  762 (41.97/28.21)	TPHLHRRRALASSAPD...EASSKGAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.01|      27|      28|     905|     932|       2
---------------------------------------------------------------------------
  905-  932 (39.68/29.86)	SLSNPAAE.QAVTDQVMKDLGLTTEgATL
  935-  962 (41.32/25.82)	SLFDPAATfDNDTDFANVNFDVAAD.ATL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     203.42|      71|     310|      17|      91|       3
---------------------------------------------------------------------------
   17-   91 (105.67/88.45)	LSNAL.....KRHIRP...EHLPLrELAARYPATQRDVADAVI..SLHDVeSYSFVNPLIPKYIEAL.VLARSTdiSDVLLSLLQH
  321-  402 (97.75/66.50)	LTNAIlrgdsSRIIRSfvcNKLPL.LLQGLFSFAEPNASEAAIqgTLSAV.NMEPLSPLTAGATEARdVLKKTR..ADFLRACVMH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.75|      41|     414|     102|     144|       4
---------------------------------------------------------------------------
  102-  144 (62.22/56.71)	HEESLASVFPSLEEQVFSLLRVLVINSKLPASQwrSKATTFTL
  519-  559 (74.52/58.39)	HDEDQSEFQPPYEEFACILLLVLVIHHRFDLTA..HEAGAFTM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.66|      22|      28|     988|    1009|       5
---------------------------------------------------------------------------
  988- 1009 (37.94/24.04)	SANMFIADSIVF...DANQPVLTGN
 1016- 1040 (33.72/20.64)	SGNVENAEEDIFaglDFEQETMDFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.86|      15|     278|     168|     187|       9
---------------------------------------------------------------------------
  168-  187 (22.67/23.21)	MAAGAGAHTGifeslCLLVI
  453-  467 (29.19/16.60)	MQGNAGAIAG.....CLIGI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13350 with Med5 domain of Kingdom Fungi
Unable to open file!