<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13334
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHEVALFSQVAQARHDRLLQTLSGVVGAQPAAYTHQHVLVNKEKLVQDLHRAVSLQQDSSTATGPWQARIASLPEPGSPEAIFSQVNELPSINNGDYEYDKVVGHHYTDGHRFVNGNVIITIYRIFATNTLLPSTSEILLLSPPCNARQLGHLDPSGAYVVEAIVRIENGTDLKFADLARKELFAFCRDYLQGVITFQVPDRFAMDTRVKGA |
Length | 212 |
Position | Head |
Organism | Rachicladosporium sp. CCFEE 5018 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium>
unclassified Rachicladosporium.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.154 |
Instability index | 36.24 |
Isoelectric point | 6.12 |
Molecular weight | 23463.26 |
Publications | PubMed=28684563
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13334
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.27| 34| 74| 5| 41| 1
---------------------------------------------------------------------------
5- 41 (53.76/36.11) ALFSQVAQ.ARHDRLLQTLSGVVGAQpaaYTHQHVLVN
81- 115 (59.51/32.85) AIFSQVNElPSINNGDYEYDKVVGHH...YTDGHRFVN
---------------------------------------------------------------------------
|