<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13322
Description |
Uncharacterized protein |
Sequence | MASNYWDSSQAKYWTFTRAELATSRNDLAKTNQALHAKHPLPDTRHLAIYLQNQLSKLAKRMSLRQQALATAQVYMKRFFLRVEIRKTNPYLIMATAVYLACKMEECPQHIRLMLGEAARQWPELGITESSKIGECEFALISTLSSRLILHHPYRALSDLQGTLGLTQEEITLAHSMLNDSYATDLPLLYPPHVIAITAIYLAVVLRPAQAAGLAAHSSSAASSPAMSGSAAQKGFSSFGFRQDPNKMGKLIDWLAESKVEMDSVVDATQELISLYDCWETYSERACKEGITKFMKDGAK |
Length | 300 |
Position | Kinase |
Organism | Rachicladosporium sp. CCFEE 5018 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium>
unclassified Rachicladosporium.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.177 |
Instability index | 53.13 |
Isoelectric point | 8.49 |
Molecular weight | 33481.15 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13322
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.20| 12| 100| 90| 101| 1
---------------------------------------------------------------------------
90- 101 (22.82/17.40) PYLIMATAVYLA
192- 203 (22.38/16.93) PHVIAITAIYLA
---------------------------------------------------------------------------
|