| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNAQLQSSYHTLEQALQRLTDSIATYNPNPVYADELVAANDAVDRDLELLAAHQSNYTRIQSLRAQSASLDSTLRSTITQLAQARKDILAIPPASSPGPTDQANELNVDTLLRYAALIAPTTVPPTLRKPIPSIEFPRVKLEGDGSVERVGGLSTPPPQPEGEQGDVKEAIVGIERIGELERGWLAGNGDVGFVPWVSDEAIRGGALAKLEGIGEGSGEVSGMEVDQQGDGGAEEEVRAEHEEQDRRRRRERARAEVRVFNPDDL |
| Length | 265 |
| Position | Middle |
| Organism | Rachicladosporium antarcticum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.541 |
| Instability index | 49.75 |
| Isoelectric point | 4.63 |
| Molecular weight | 28705.42 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP13314
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 114.44| 24| 26| 130| 153| 1
---------------------------------------------------------------------------
130- 153 (42.67/23.16) PIPSIEFPRVKLEGDGSVERVGGL
158- 180 (37.36/19.50) PQPEGEQGDVK.EAIVGIERIGEL
201- 223 (34.41/17.47) AIRGGALAKLEGIGEGSGE.VSGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 116.34| 36| 67| 1| 51| 2
---------------------------------------------------------------------------
1- 36 (61.55/56.05) MNAQLQSSYHTLEQALQRLTDSIATYNPNPV.YADEL
70- 106 (54.80/25.79) LDSTLRSTITQLAQARKDILAIPPASSPGPTdQANEL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EEVRAEHEE 2) LLRYAALI | 235 111 | 243 118 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab