Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNAQLQSSYHTLEQALQRLTDSIATYNPNPVYADELVAANDAVDRDLELLAAHQSNYTRIQSLRAQSASLDSTLRSTITQLAQARKDILAIPPASSPGPTDQANELNVDTLLRYAALIAPTTVPPTLRKPIPSIEFPRVKLEGDGSVERVGGLSTPPPQPEGEQGDVKEAIVGIERIGELERGWLAGNGDVGFVPWVSDEAIRGGALAKLEGIGEGSGEVSGMEVDQQGDGGAEEEVRAEHEEQDRRRRRERARAEVRVFNPDDL |
Length | 265 |
Position | Middle |
Organism | Rachicladosporium antarcticum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.541 |
Instability index | 49.75 |
Isoelectric point | 4.63 |
Molecular weight | 28705.42 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13314 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 114.44| 24| 26| 130| 153| 1 --------------------------------------------------------------------------- 130- 153 (42.67/23.16) PIPSIEFPRVKLEGDGSVERVGGL 158- 180 (37.36/19.50) PQPEGEQGDVK.EAIVGIERIGEL 201- 223 (34.41/17.47) AIRGGALAKLEGIGEGSGE.VSGM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 116.34| 36| 67| 1| 51| 2 --------------------------------------------------------------------------- 1- 36 (61.55/56.05) MNAQLQSSYHTLEQALQRLTDSIATYNPNPV.YADEL 70- 106 (54.80/25.79) LDSTLRSTITQLAQARKDILAIPPASSPGPTdQANEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEVRAEHEE 2) LLRYAALI | 235 111 | 243 118 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab