<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13311
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MLTRPPVSSTSRPPLPTRSVTIGQQYPHTQQLRRPALPSRLSSVRSASGPSQHVNLDQYDSAWRNEVAQKNNASLGHVESGEDVTEEGRPRKKAKIESEEIMVSSPTDLDDEVHDIPPDEAHAFLPGAPMPLPPGPQPALRKPTPKNRLNHDPLRKAIGLQPPAIAIRLPAPKSIADFSPWSGTHPEDVLNETIIKGGYYDKPPNPSQNETNSARHSIWPNLSQKNNVALHTLSHLFTQVLEKRAAMGRITAPSSFKPPPRVTVTDTKREAWLKDLANLAIPLRRQSRTIPHGIRGKGLLEQCLAKEIPLSRAIWLAKCVGANELRAFRRKGVSGTAGAQGEAKWLRDWTVGVQQFFEGVVAECGKEDWRKQIDYAIKLTSSLYTEGLVEKEEFLDWVVRMLGSAEEKNLPLWAIM |
| Length | 416 |
| Position | Kinase |
| Organism | Rachicladosporium sp. CCFEE 5018 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium>
unclassified Rachicladosporium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.582 |
| Instability index | 53.24 |
| Isoelectric point | 9.37 |
| Molecular weight | 46213.09 |
| Publications | |
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13311
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.60| 14| 21| 5| 22| 1
---------------------------------------------------------------------------
5- 18 (27.46/15.45) PPVSSTSRPPLPTR
27- 40 (27.15/ 7.53) PHTQQLRRPALPSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.79| 14| 22| 125| 138| 2
---------------------------------------------------------------------------
125- 138 (29.95/13.19) LPGAPMPLPPGPQP
149- 162 (23.84/ 9.23) LNHDPLRKAIGLQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.00| 14| 22| 332| 345| 3
---------------------------------------------------------------------------
332- 345 (25.67/18.20) GVS....GTAGAQGEAKW
352- 369 (21.33/13.91) GVQqffeGVVAECGKEDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.72| 29| 153| 50| 80| 4
---------------------------------------------------------------------------
50- 80 (45.01/42.10) PSQHVNLDQYDSAWRNeVAQKNNASLgHVES
206- 234 (53.71/38.73) PSQNETNSARHSIWPN.LSQKNNVAL.HTLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 22.61| 7| 24| 281| 290| 6
---------------------------------------------------------------------------
281- 290 ( 8.83/12.64) IPLrrqSRTI
308- 314 (13.78/ 6.73) IPL...SRAI
---------------------------------------------------------------------------
|