<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13308
| Description |
Uncharacterized protein |
| Sequence | MASNYWDSSQAKYWTFTRADLATSRDDLAKTNQALHTKHPLPDTRHLAIYLQNQLSKLAKRMSLRQQALATAQVYMKRFFLRVEIRKTNPYLIMATAVYLACKMEECPQHIRLMLGEAARQWPELGITESSKIGECEFALISTLSSRLILHHPYRALSDLQGTLGLTQEEITLAHSMLNDSYATDLPLLYPPHVIAITAIYLAVVLRPAQAAGLAAHSSSAASSPAMSGSVAQKAFSSFGFRQDPNKMGKLIDWLAESKVEMESVVDATQELISLYDCWETYSERACKEGITKFMKDGAK |
| Length | 300 |
| Position | Kinase |
| Organism | Rachicladosporium antarcticum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.170 |
| Instability index | 52.46 |
| Isoelectric point | 8.19 |
| Molecular weight | 33554.24 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13308
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.20| 12| 100| 90| 101| 1
---------------------------------------------------------------------------
90- 101 (22.82/16.28) PYLIMATAVYLA
192- 203 (22.38/15.84) PHVIAITAIYLA
---------------------------------------------------------------------------
|