Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MGDLQKIMESSQELFKTAHAYPHAPFPGTTFEGNLILARLLRKRVEPDVEAWIKEHTEDAKVQQWYEYRGTGLQQDEQQRLWKHAAEENARVLEELVTKGAMDFDYTLAEYEEGVGKARTGLKRKLQKKLRNLAADEDEDDEDEEDSEDEDDEMEDVMPDAPVQPPPLNEVKGLIPGAYAMRLEDVLKFITTGVRPK |
Length | 197 |
Position | Head |
Organism | Rachicladosporium antarcticum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.877 |
Instability index | 49.90 |
Isoelectric point | 4.60 |
Molecular weight | 22602.97 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13306 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.53| 31| 47| 59| 89| 1 --------------------------------------------------------------------------- 59- 89 (57.81/36.50) DAKVQQWYEYRG...TGLQQDEQQRLWKHAAEEN 105- 138 (46.73/28.32) DYTLAEYEEGVGkarTGLKRKLQKKLRNLAADED --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) KLRNLAADEDEDDEDEEDSEDEDDEMEDVMPDAPVQPPPLNEVKGLI | 129 | 175 |
MoRF Sequence | Start | Stop |
1) LKRKLQKK 2) MRLEDVLKFITT 3) PLNEVKGLIPGAY | 122 181 167 | 129 192 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab